PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10017096
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family MYB
Protein Properties Length: 264aa    MW: 28917.9 Da    PI: 10.4168
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10017096genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.42.9e-174289148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg+WT eEd +l ++++  G g+W++ ar+ g++Rt+k+c++rw++yl
      Lus10017096 42 RGPWTVEEDFKLMNYIATNGEGRWNSLARCAGLKRTGKSCRLRWLNYL 89
                     89********************************************97 PP

2Myb_DNA-binding50.74.3e-1695138146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg+ T eE++ ++d++ ++G++ W++Ia++++ gRt++++k++w++
      Lus10017096  95 RGNITLEEQLMILDLHSRWGNR-WSKIAQHLP-GRTDNEIKNYWRT 138
                      7999******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.6363789IPR017930Myb domain
SuperFamilySSF466894.49E-3040136IPR009057Homeodomain-like
SMARTSM007178.4E-144191IPR001005SANT/Myb domain
PfamPF002491.6E-154289IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.4E-224396IPR009057Homeodomain-like
CDDcd001671.58E-104489No hitNo description
PROSITE profilePS5129422.36190144IPR017930Myb domain
SMARTSM007174.1E-1494142IPR001005SANT/Myb domain
PfamPF002492.2E-1495138IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.5E-2397143IPR009057Homeodomain-like
CDDcd001678.99E-1199138No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 264 aa     Download sequence    Send to blast
MDANYGSTGG GGSINNSQQR SSSSSSSSSG GGAEEEMSEL RRGPWTVEED FKLMNYIATN  60
GEGRWNSLAR CAGLKRTGKS CRLRWLNYLR PDVRRGNITL EEQLMILDLH SRWGNRWSKI  120
AQHLPGRTDN EIKNYWRTRV QKHAKQLKCD VNSKQFKDTM RYLWMPRLIE RIQAATTTTT  180
TLPSTSASPA AXXGGPACRS LGCRGRTHDG GGAKWQLQRG GVDVGGLVWC TGGFAHVGHD  240
GLLQRSNGRC KSRVGPEPDG GGI*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C5e-253913624120MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011027944.11e-103PREDICTED: transcription factor MYB108-like
SwissprotQ9LDE13e-86MY108_ARATH; Transcription factor MYB108
TrEMBLB9HIK13e-96B9HIK1_POPTR; GmMYB12 family protein
STRINGPOPTR_0008s10080.18e-96(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF87534125
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G06490.12e-85myb domain protein 108